PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009626582.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 285aa    MW: 31600.9 Da    PI: 9.3301
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009626582.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.31.9e-31128184158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep++VNaKQy++Il+RRq Rak+e ekk  +k+rkpylheSRh+hA+rR+Rg+gGrF
  XP_009626582.1 128 EEPVFVNAKQYHGILRRRQIRAKAELEKKA-IKARKPYLHESRHQHAMRRARGTGGRF 184
                     69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.1E-36126187IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.628127187IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.2E-27129184IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.7E-24130152IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860132152IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.7E-24161184IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MTSQSTTQMQ PWWQGYGDNT MSLVSENTVA QGNAEGGNEE KETNAQATES GSKGNNVQYK  60
QHLKHITSTT VTIMGEQQKE LTGHSAMLTS YPYPDLQYGG MMTYGAPVHP HLFEIHHARM  120
PLPLDMEEEP VFVNAKQYHG ILRRRQIRAK AELEKKAIKA RKPYLHESRH QHAMRRARGT  180
GGRFLNTKKL NDMDCITDEA KKYGATIPTH SGNSSGSGSS DQREKEGSTV QDMHKGQRSF  240
STGNGHGSSV YFSQYAGNEQ QNGHYSHGSW SLLVSQASRG AASNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-20128188262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754401e-106HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626582.10.0PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X3
TrEMBLM1A9B51e-171M1A9B5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000176981e-170(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.17e-30nuclear factor Y, subunit A7